TR030711

From GPTWiki
Revision as of 16:10, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Transition |label=Y{{!(}}pH3N3F{{!)}} |mz1=993.465 |mz2=966.457 |peptide=PE001542 |z1=6 |z2=6 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H4N3F]FTTAPAICHDGK.A (PE001542)
Prec. m/z 993.465
Prec. z 6+
Prod. m/z 966.457
Prod. z 6+
Label Y[pH3N3F]
Trans. Group(s) TG004183