TR030540

From GPTWiki
Revision as of 21:45, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Transition |label=Y{{!(}}pH4N3F{{!)}} |mz1=1309.809 |mz2=1545.726 |peptide=PE002178 |z1=5 |z2=4 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.VFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQN[H5N4F]VTAR.N (PE002178)
Prec. m/z 1309.809
Prec. z 5+
Prod. m/z 1545.726
Prod. z 4+
Label Y[pH4N3F]
Trans. Group(s) TG006379