TR025573

From GPTWiki
Revision as of 21:19, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Transition |label=Y{{!(}}pH3N2{{!)}} |mz1=1401.448 |mz2=1897.590 |peptide=PE001836 |z1=5 |z2=3 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.SPQELLCGASLISDRWVLTAAHCLLYPPWDKN[H5N4S2]FTENDLLVR.I (PE001836)
Prec. m/z 1401.448
Prec. z 5+
Prod. m/z 1897.590
Prod. z 3+
Label Y[pH3N2]
Trans. Group(s) TG005105