TR024503

From GPTWiki
Revision as of 15:37, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Transition |label=Y{{!(}}pN2F{{!)}} |mz1=880.239 |mz2=1147.545 |peptide=PE001773 |z1=6 |z2=4 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N3F]STEAGQK.L (PE001773)
Prec. m/z 880.239
Prec. z 6+
Prod. m/z 1147.545
Prod. z 4+
Label Y[pN2F]
Trans. Group(s) TG004698