TR024470

From GPTWiki
Revision as of 01:51, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Transition |label=Y{{!(}}pH3N2F{{!)}}* |mz1=914.085 |mz2=1269.084 |peptide=PE001772 |z1=6 |z2=4 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N4F]STEAGQK.L (PE001772)
Prec. m/z 914.085
Prec. z 6+
Prod. m/z 1269.084
Prod. z 4+
Label Y[pH3N2F]*
Trans. Group(s) TG004726, TG004775