TR024462

From GPTWiki
Revision as of 21:11, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Transition |label=Y{{!(}}pNF{{!)}}* |mz1=1096.701 |mz2=1462.030 |peptide=PE001772 |z1=5 |z2=3 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N4F]STEAGQK.L (PE001772)
Prec. m/z 1096.701
Prec. z 5+
Prod. m/z 1462.030
Prod. z 3+
Label Y[pNF]*
Trans. Group(s) TG004713