TR024427

From GPTWiki
Revision as of 16:48, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Transition |label=Y{{!(}}pH4N4FS{{!)}} |mz1=1016.619 |mz2=1187.330 |peptide=PE001770 |z1=6 |z2=5 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H5N4FS]STEAGQK.L (PE001770)
Prec. m/z 1016.619
Prec. z 6+
Prod. m/z 1187.330
Prod. z 5+
Label Y[pH4N4FS]
Trans. Group(s) TG004670