TR024389

From GPTWiki
Revision as of 04:46, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Transition |label=Y{{!(}}pH3N2{{!)}} |mz1=855.896 |mz2=986.257 |peptide=PE001769 |z1=6 |z2=5 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N3]STEAGQK.L (PE001769)
Prec. m/z 855.896
Prec. z 6+
Prod. m/z 986.257
Prod. z 5+
Label Y[pH3N2]
Trans. Group(s) TG004655