TR022767

From GPTWiki
Revision as of 02:14, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Transition |label=Y{{!(}}pH4N3{{!)}} |mz1=853.971 |mz2=830.820 |peptide=PE001616 |z1=7 |z2=7 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N3]FTTAPAICHDGK.A (PE001616)
Prec. m/z 853.971
Prec. z 7+
Prod. m/z 830.820
Prod. z 7+
Label Y[pH4N3]
Trans. Group(s) TG004234