TR022762

From GPTWiki
Revision as of 07:30, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Transition |label=Y{{!(}}pH4N2{{!)}} |mz1=853.971 |mz2=935.276 |peptide=PE001616 |z1=7 |z2=6 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N3]FTTAPAICHDGK.A (PE001616)
Prec. m/z 853.971
Prec. z 7+
Prod. m/z 935.276
Prod. z 6+
Label Y[pH4N2]
Trans. Group(s) TG004234