TR022132

From GPTWiki
Revision as of 05:20, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Transition |label=Y{{!(}}pH3N3F{{!)}} |mz1=1034.150 |mz2=1159.546 |peptide=PE001556 |z1=6 |z2=5 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H3N5F]FTTAPAICHDGK.A (PE001556)
Prec. m/z 1034.150
Prec. z 6+
Prod. m/z 1159.546
Prod. z 5+
Label Y[pH3N3F]
Trans. Group(s) TG004106