TR022103

From GPTWiki
Revision as of 21:52, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Transition |label=Y{{!(}}pH6N5F{{!)}} |mz1=1454.448 |mz2=1338.010 |peptide=PE001554 |z1=5 |z2=5 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N5FS2]FTTAPAICHDGK.A (PE001554)
Prec. m/z 1454.448
Prec. z 5+
Prod. m/z 1338.010
Prod. z 5+
Label Y[pH6N5F]
Trans. Group(s) TG004174, TG004246