TR022084

From GPTWiki
Revision as of 07:57, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Transition |label=Y{{!(}}pH4N4F{{!)}} |mz1=1054.321 |mz2=1027.312 |peptide=PE001553 |z1=6 |z2=6 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N4F]FTTAPAICHDGK.A (PE001553)
Prec. m/z 1054.321
Prec. z 6+
Prod. m/z 1027.312
Prod. z 6+
Label Y[pH4N4F]
Trans. Group(s) TG004164