TR022066

From GPTWiki
Revision as of 01:17, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Transition |label=Y{{!(}}pN2{{!)}} |mz1=961.870 |mz2=1240.357 |peptide=PE001551 |z1=7 |z2=4 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N6F]FTTAPAICHDGK.A (PE001551)
Prec. m/z 961.870
Prec. z 7+
Prod. m/z 1240.357
Prod. z 4+
Label Y[pN2]
Trans. Group(s) TG004097