TR021935

From GPTWiki
Revision as of 16:40, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Transition |label=Y{{!(}}pN{{!)}} |mz1=851.686 |mz2=951.871 |peptide=PE001542 |z1=7 |z2=5 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H4N3F]FTTAPAICHDGK.A (PE001542)
Prec. m/z 851.686
Prec. z 7+
Prod. m/z 951.871
Prod. z 5+
Label Y[pN]
Trans. Group(s) TG004143, TG004196