TR017293

From GPTWiki
Revision as of 04:57, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Transition |label=Y{{!(}}pH2N2{{!)}} |mz1=1500.660 |mz2=1790.184 |peptide=PE001179 |z1=5 |z2=3 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide R.NQALN[H6N5S3]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N (PE001179)
Prec. m/z 1500.660
Prec. z 5+
Prod. m/z 1790.184
Prod. z 3+
Label Y[pH2N2]
Trans. Group(s) TG002782, TG003436, TG005081