TR016767

From GPTWiki
Revision as of 23:45, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Transition |label=Y{{!(}}pN{{!)}} |mz1=1372.614 |mz2=1619.787 |peptide=PE000438 |z1=5 |z2=3 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide R.NQALN[H5N4S2]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPM[Ox]EGESR.N (PE000438)
Prec. m/z 1372.614
Prec. z 5+
Prod. m/z 1619.787
Prod. z 3+
Label Y[pN]
Trans. Group(s) TG000395, TG000856, TG003519