TR006140

From GPTWiki
Revision as of 23:19, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Transition |label=Y{{!(}}pH3N3{{!)}} |mz1=1372.614 |mz2=1438.171 |peptide=PE000438 |z1=5 |z2=4 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide R.NQALN[H5N4S2]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPM[Ox]EGESR.N (PE000438)
Prec. m/z 1372.614
Prec. z 5+
Prod. m/z 1438.171
Prod. z 4+
Label Y[pH3N3]
Trans. Group(s) TG000395, TG000856, TG003519