TR002988

From GPTWiki
Revision as of 00:26, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Transition |label=Y{{!(}}pHN2{{!)}} |mz1=1619.852 |mz2=1856.078 |peptide=PE000162 |z1=6 |z2=4 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.IQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFN[H6N5S3]CSESFTMIGHR.S (PE000162)
Prec. m/z 1619.852
Prec. z 6+
Prod. m/z 1856.078
Prod. z 4+
Label Y[pHN2]
Trans. Group(s) TG000397