TR002013

From GPTWiki
Revision as of 22:53, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Transition |label=Y{{!(}}pHN2{{!)}} |mz1=910.741 |mz2=1183.901 |peptide=PE000243 |z1=7 |z2=4 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.QLVLKAPDKNVIFSPLSISTALAFLSLGAHN[H5N4S2]TTLTEILK.G (PE000243)
Prec. m/z 910.741
Prec. z 7+
Prod. m/z 1183.901
Prod. z 4+
Label Y[pHN2]
Trans. Group(s) TG000369