TR001547

From GPTWiki
Revision as of 17:24, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Transition |label=Y{{!(}}pH3N2{{!)}} |mz1=1173.302 |mz2=1393.840 |peptide=PE000225 |z1=8 |z2=6 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N4S]GSLFAFR.G (PE000225)
Prec. m/z 1173.302
Prec. z 8+
Prod. m/z 1393.840
Prod. z 6+
Label Y[pH3N2]
Trans. Group(s) TG000265, TG001125