TR000492

From GPTWiki
Revision as of 14:45, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Transition |label=Y{{!(}}pH5N4F{{!)}} |mz1=1407.451 |mz2=1667.779 |peptide=PE000345 |z1=5 |z2=4 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide R.SDHGSSISCQPPAEIPGYLPADTVHLAVEFFN[H6N5F]LTHLPANLLQGASK.L (PE000345)
Prec. m/z 1407.451
Prec. z 5+
Prod. m/z 1667.779
Prod. z 4+
Label Y[pH5N4F]
Trans. Group(s)