TG010782

From GPTWiki
Revision as of 14:51, 1 July 2021 by Edwardsnj (talk | contribs) (Created page with "{{TransitionGroup |extraction=OpenSWATH |fdr=0.000 |intensity=432110.000 |mz1=1437.158 |nrt=161.194 |ntransition=13 |peptide=PE000247 |prt=52.666 |rt=52.666 |score=1.565 |spec...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.YLGN[H5N4S2]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000247)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4S2 (N4)
Mod(s)
Molecular Weight 5,762.613
Charge 4+
Protein SERPINA1 (P01009)
Spectrum File DataMS_Human_serum_MARS14_DIA_lce03n
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction MARS14 Depleted
Sample Human Serum
Extraction OpenSWATH
Intensity 432110.000
Score 1.565
FDR 0%

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
52.666 52.666 161.194 1,437.158 4+ 1,697.133 3+ Y[pH4N3S] 100.0
52.666 52.666 161.194 1,437.158 4+ 1,600.101 3+ Y[pH4N3] 80.9
52.666 52.666 161.194 1,437.158 4+ 1,546.083 3+ Y[pH3N3] 48.2
52.666 52.666 161.194 1,437.158 4+ 1,643.115 3+ Y[pH3N3S] 44.4
52.666 52.666 161.194 1,437.158 4+ 1,872.463 2+ Y[pN] 43.2
52.666 52.666 161.194 1,437.158 4+ 1,248.644 3+ Y[pN] 34.8
52.666 52.666 161.194 1,437.158 4+ 1,721.812 3+ Y[pH5N4] 16.2
52.666 52.666 161.194 1,437.158 4+ 1,424.373 3+ Y[pH2N2] 11.8
52.666 52.666 161.194 1,437.158 4+ 1,478.390 3+ Y[pH3N2] 7.3
52.666 52.666 161.194 1,437.158 4+ 1,364.385 4+ Y[pH5N4S] 5.5
52.666 52.666 161.194 1,437.158 4+ 1,316.337 3+ Y[pN2] 5.0
52.666 52.666 161.194 1,437.158 4+ 1,370.355 3+ Y[pHN2] 3.1
52.666 52.666 161.194 1,437.158 4+ 1,291.611 4+ Y[pH5N4] 1.7