TG010333

From GPTWiki
Revision as of 19:15, 30 June 2021 by Edwardsnj (talk | contribs) (Created page with "{{TransitionGroup |extraction=OpenSWATH |fdr=0.000 |intensity=718019.000 |mz1=1437.158 |nrt=158.395 |ntransition=13 |peptide=PE000247 |prt=52.693 |rt=52.693 |score=3.750 |spec...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.YLGN[H5N4S2]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000247)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4S2 (N4)
Mod(s)
Molecular Weight 5,762.613
Charge 4+
Protein SERPINA1 (P01009)
Spectrum File DataMS_Human_serum_MARS2_DIA_lce02
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction MARS2 Depleted
Sample Human Serum
Extraction OpenSWATH
Intensity 718019.000
Score 3.750
FDR 0%

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
52.693 52.693 158.395 1,437.158 4+ 1,600.101 3+ Y[pH4N3] 100.0
52.693 52.693 158.395 1,437.158 4+ 1,697.133 3+ Y[pH4N3S] 81.5
52.693 52.693 158.395 1,437.158 4+ 1,364.385 4+ Y[pH5N4S] 58.6
52.693 52.693 158.395 1,437.158 4+ 1,546.083 3+ Y[pH3N3] 42.7
52.693 52.693 158.395 1,437.158 4+ 1,643.115 3+ Y[pH3N3S] 28.6
52.693 52.693 158.395 1,437.158 4+ 1,248.644 3+ Y[pN] 19.2
52.693 52.693 158.395 1,437.158 4+ 1,872.463 2+ Y[pN] 15.5
52.693 52.693 158.395 1,437.158 4+ 1,721.812 3+ Y[pH5N4] 14.7
52.693 52.693 158.395 1,437.158 4+ 1,291.611 4+ Y[pH5N4] 10.3
52.693 52.693 158.395 1,437.158 4+ 1,478.390 3+ Y[pH3N2] 9.3
52.693 52.693 158.395 1,437.158 4+ 1,424.373 3+ Y[pH2N2] 9.1
52.693 52.693 158.395 1,437.158 4+ 1,316.337 3+ Y[pN2] 4.6
52.693 52.693 158.395 1,437.158 4+ 1,370.355 3+ Y[pHN2] 2.7