TG010248

From GPTWiki
Revision as of 19:03, 30 June 2021 by Edwardsnj (talk | contribs) (Created page with "{{TransitionGroup |extraction=OpenSWATH |fdr=0.000 |intensity=38406.800 |mz1=1369.415 |nrt=153.398 |ntransition=12 |peptide=PE000439 |prt=51.610 |rt=51.610 |score=3.371 |spect...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide R.NQALN[H5N4S2]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N (PE000439)
Sequence NQALNLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR
Glycans(s) H5N4S2 (N5)
Mod(s)
Molecular Weight 6,860.046
Charge 5+
Protein ITIH4 (Q14624)
Spectrum File DataMS_Human_serum_MARS2_DIA_lce02
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction MARS2 Depleted
Sample Human Serum
Extraction OpenSWATH
Intensity 38406.800
Score 3.371
FDR 0%

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
51.610 51.610 153.398 1,369.415 5+ 1,547.460 4+ Y[pH4N3S] 100.0
51.610 51.610 153.398 1,369.415 5+ 1,474.686 4+ Y[pH4N3] 48.6
51.610 51.610 153.398 1,369.415 5+ 1,844.201 3+ Y[pH3N2] 42.0
51.610 51.610 153.398 1,369.415 5+ 1,614.455 3+ Y[pN] 33.3
51.610 51.610 153.398 1,369.415 5+ 1,506.947 4+ Y[pH3N3S] 32.5
51.610 51.610 153.398 1,369.415 5+ 1,790.184 3+ Y[pH2N2] 31.3
51.610 51.610 153.398 1,369.415 5+ 1,434.173 4+ Y[pH3N3] 24.5
51.610 51.610 153.398 1,369.415 5+ 1,211.093 4+ Y[pN] 15.2
51.610 51.610 153.398 1,369.415 5+ 1,638.743 4+ Y[pH5N4S] 14.4
51.610 51.610 153.398 1,369.415 5+ 1,565.969 4+ Y[pH5N4] 11.6
51.610 51.610 153.398 1,369.415 5+ 1,736.166 3+ Y[pHN2] 10.4
51.610 51.610 153.398 1,369.415 5+ 1,546.762 3+ Y[p] 2.1