TG009745

From GPTWiki
Revision as of 17:40, 30 June 2021 by Edwardsnj (talk | contribs) (Created page with "{{TransitionGroup |extraction=OpenSWATH |fdr=0.000 |intensity=72229.100 |mz1=1433.161 |nrt=181.705 |ntransition=14 |peptide=PE001186 |prt=56.598 |rt=56.598 |score=5.473 |spect...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.SSVITLNTNAELFN[H9N2]QSDIVAHLLSSSSSVIDALQYK.L (PE001186)
Sequence SSVITLNTNAELFNQSDIVAHLLSSSSSVIDALQYK
Glycans(s) H9N2 (N14)
Mod(s)
Molecular Weight 5,746.624
Charge 4+
Protein APOB (P04114)
Spectrum File DataMS_Human_serum_MARS2_DIA_lce01
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction MARS2 Depleted
Sample Human Serum
Extraction OpenSWATH
Intensity 72229.100
Score 5.473
FDR 0%

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
56.598 56.598 181.705 1,433.161 4+ 1,356.694 3+ Y[pN] 100.0
56.598 56.598 181.705 1,433.161 4+ 1,230.595 4+ Y[pH4N2] 15.5
56.598 56.598 181.705 1,433.161 4+ 1,271.108 4+ Y[pH5N2] 13.1
56.598 56.598 181.705 1,433.161 4+ 1,352.135 4+ Y[pH7N2] 10.4
56.598 56.598 181.705 1,433.161 4+ 1,190.082 4+ Y[pH3N2] 10.3
56.598 56.598 181.705 1,433.161 4+ 1,424.387 3+ Y[pN2] 10.0
56.598 56.598 181.705 1,433.161 4+ 1,640.458 3+ Y[pH4N2] 9.4
56.598 56.598 181.705 1,433.161 4+ 1,149.569 4+ Y[pH2N2] 9.3
56.598 56.598 181.705 1,433.161 4+ 1,478.405 3+ Y[pHN2] 7.5
56.598 56.598 181.705 1,433.161 4+ 1,109.056 4+ Y[pHN2] 5.4
56.598 56.598 181.705 1,433.161 4+ 1,532.422 3+ Y[pH2N2] 5.0
56.598 56.598 181.705 1,433.161 4+ 1,586.440 3+ Y[pH3N2] 4.0
56.598 56.598 181.705 1,433.161 4+ 1,068.542 4+ Y[pN2] 2.3
56.598 56.598 181.705 1,433.161 4+ 1,289.001 3+ Y[p] 1.5