TG009706

From GPTWiki
Revision as of 15:43, 1 July 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.SLGNVN[H5N4S]FTVSAEALESQELCGTEVPSVPEHGRK.D (PE000232)
Sequence SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK
Glycans(s) H5N4S (N6)
Mod(s) 57.021 (C20)
Molecular Weight 5,472.403
Charge 4+
Protein A2M (P01023)
Spectrum File DataMS_Human_serum_MARS2_DIA_lce01
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction MARS2 Depleted
Sample Human Serum