TG008765

From GPTWiki
Revision as of 13:30, 30 June 2021 by Edwardsnj (talk | contribs) (Created page with "{{TransitionGroup |extraction=OpenSWATH |fdr=0.000 |intensity=132225.000 |mz1=1433.161 |nrt=195.916 |ntransition=14 |peptide=PE001186 |prt=59.784 |rt=59.784 |score=3.074 |spec...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.SSVITLNTNAELFN[H9N2]QSDIVAHLLSSSSSVIDALQYK.L (PE001186)
Sequence SSVITLNTNAELFNQSDIVAHLLSSSSSVIDALQYK
Glycans(s) H9N2 (N14)
Mod(s)
Molecular Weight 5,746.624
Charge 4+
Protein APOB (P04114)
Spectrum File DataMS_Human_serum_MARS14_DIA_lce03
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction MARS14 Depleted
Sample Human Serum
Extraction OpenSWATH
Intensity 132225.000
Score 3.074
FDR 0%

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
59.784 59.784 195.916 1,433.161 4+ 1,356.694 3+ Y[pN] 100.0
59.784 59.784 195.916 1,433.161 4+ 1,230.595 4+ Y[pH4N2] 12.0
59.784 59.784 195.916 1,433.161 4+ 1,271.108 4+ Y[pH5N2] 10.2
59.784 59.784 195.916 1,433.161 4+ 1,424.387 3+ Y[pN2] 8.1
59.784 59.784 195.916 1,433.161 4+ 1,190.082 4+ Y[pH3N2] 8.0
59.784 59.784 195.916 1,433.161 4+ 1,149.569 4+ Y[pH2N2] 8.0
59.784 59.784 195.916 1,433.161 4+ 1,640.458 3+ Y[pH4N2] 7.5
59.784 59.784 195.916 1,433.161 4+ 1,478.405 3+ Y[pHN2] 6.6
59.784 59.784 195.916 1,433.161 4+ 1,532.422 3+ Y[pH2N2] 5.9
59.784 59.784 195.916 1,433.161 4+ 1,352.135 4+ Y[pH7N2] 4.9
59.784 59.784 195.916 1,433.161 4+ 1,109.056 4+ Y[pHN2] 4.8
59.784 59.784 195.916 1,433.161 4+ 1,586.440 3+ Y[pH3N2] 4.2
59.784 59.784 195.916 1,433.161 4+ 1,068.542 4+ Y[pN2] 1.8
59.784 59.784 195.916 1,433.161 4+ 1,289.001 3+ Y[p] 1.3