TG006388

From GPTWiki
Revision as of 16:06, 12 May 2021 by Edwardsnj (talk | contribs)
Jump to navigation Jump to search
Peptide K.GHDLNEDGLVSWEEYKN[H3N5F]ATYGYVLDDPDPDDGFNYK.Q (PE002179)
Sequence GHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYK
Glycans(s) H3N5F (N17)
Mod(s)
Molecular Weight 5,815.427
Charge 4+
Protein CALU (O43852)
Spectrum File MS_47_UO1_HEK_1_2n
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample HEK293 Cells

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
49.825 49.790 88.117 1,450.362 4+ 1,865.787 3+ Y[pH3N4F] 35.5
49.825 49.790 88.117 1,450.362 4+ 1,798.094 3+ Y[pH3N3F] 8.7
49.825 49.790 88.117 1,450.362 4+ 1,500.655 3+ Y[pNF] 6.7
49.825 49.790 88.117 1,450.362 4+ 1,399.592 4+ Y[pH3N4F] 5.3

Spectra

13303;EThcD;49.819;13294;1450.620;Byonic:q-value=4.8e-12/GPS:MinICScore=18.282
13305;HCD;49.825;13294;1450.620;