TG006383

From GPTWiki
Revision as of 18:37, 20 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.GHDLNEDGLVSWEEYKN[H3N4F]ATYGYVLDDPDPDDGFNYK.Q (PE001256)
Sequence GHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYK
Glycans(s) H3N4F (N17)
Mod(s)
Molecular Weight 5,612.347
Charge 4+
Protein CALU (O43852)
Spectrum File MS_47_UO1_HEK_1_2n
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample HEK293 Cells

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
49.919 49.818 1,399.592 4+ 1,798.094 3+ Y[pH3N3F] 38.3
49.919 49.818 1,399.592 4+ 1,749.408 3+ Y[pH3N3] 7.9
49.919 49.818 1,399.592 4+ 1,500.655 3+ Y[pNF]* 7.3
49.919 49.818 1,399.592 4+ 1,676.383 3+ Y[pH2N2F]* 5.7

Spectra

13334;EThcD;49.913;13329;1399.595;Byonic:q-value=3.5e-12/GPS:MinICScore=21.977
13336;HCD;49.919;13329;1399.595;