TG005920

From GPTWiki
Revision as of 16:02, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{TransitionGroup |peptide=PE002034 |spectra=MS_51_HEK_acetone_z2incl |z1=4 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide R.IQNILSEKPTVTTVYANN[H8N2]GSVLQGSSVASVYDGK.L (PE002034)
Sequence IQNILSEKPTVTTVYANNGSVLQGSSVASVYDGK
Glycans(s) H8N2 (N18)
Mod(s)
Molecular Weight 5,259.407
Charge 4+
Protein PON2 (Q15165)
Spectrum File MS_51_HEK_acetone_z2incl
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction
Sample HEK293 Cells