TG005294

From GPTWiki
Revision as of 17:21, 23 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.SLGNVN[H5N4S]FTVSAEALESQELCGTEVPSVPEHGRK.D (PE000232)
Sequence SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK
Glycans(s) H5N4S (N6)
Mod(s) 57.021 (C20)
Molecular Weight 5,472.403
Charge 4+
Protein A2M (P01023)
Spectrum File MS_51_plasma_ihilic_B1
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction iHILIC
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
59.673 59.542 73.340 1,364.609 4+ 1,600.400 3+ Y[pH4N3] 49.1
59.673 59.542 73.340 1,364.609 4+ 1,546.383 3+ Y[pH3N3] 21.5
59.673 59.542 73.340 1,364.609 4+ 1,291.835 4+ Y[pH5N4] 21.2
59.673 59.542 73.340 1,364.609 4+ 1,722.111 3+ Y[pH5N4] 12.2
59.673 59.542 73.340 1,364.609 4+ 1,248.944 3+ Y[pN] 6.5
59.673 59.542 73.340 1,364.609 4+ 1,424.672 3+ Y[pH2N2] 5.2
59.673 59.542 73.340 1,364.609 4+ 1,478.690 3+ Y[pH3N2] 5.1

Spectra

12322;EThcD;59.663;12318;1364.614;Byonic:q-value=0.00013/GPS:MinICScore=10.145
12324;HCD;59.673;12318;1364.614;