Difference between revisions of "TG005154"

From GPTWiki
Jump to navigation Jump to search
 
Line 4: Line 4:
 
|nrt=65.558
 
|nrt=65.558
 
|ntransition=9
 
|ntransition=9
|pepnrt=use (+0.000)
+
|pepnrt=use (-0.000)
 
|peptide=PE000687
 
|peptide=PE000687
 
|prt=40.482
 
|prt=40.482

Latest revision as of 18:16, 23 May 2021

Peptide R.ESKPLTAQQTTKLDAPTNLQFVN[H5N4S2]ETDSTVLVR.W (PE000687)
Sequence ESKPLTAQQTTKLDAPTNLQFVNETDSTVLVR
Glycans(s) H5N4S2 (N23)
Mod(s)
Molecular Weight 5,766.625
Charge 4+
Protein FN1 (P02751)
Spectrum File MS_51_plasma_1ul
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
40.523 40.482 65.558 1,438.161 4+ 1,365.388 4+ Y[pH5N4S] 45.0
40.523 40.482 65.558 1,438.161 4+ 1,601.438 3+ Y[pH4N3] 33.2
40.523 40.482 65.558 1,438.161 4+ 1,249.982 3+ Y[pN] 19.3
40.523 40.482 65.558 1,438.161 4+ 1,547.421 3+ Y[pH3N3] 16.6
40.523 40.482 65.558 1,438.161 4+ 1,698.470 3+ Y[pH4N3S] 15.8
40.523 40.482 65.558 1,438.161 4+ 1,723.149 3+ Y[pH5N4] 7.8
40.523 40.482 65.558 1,438.161 4+ 1,644.453 3+ Y[pH3N3S] 7.2
40.523 40.482 65.558 1,438.161 4+ 1,292.614 4+ Y[pH5N4] 6.2
40.523 40.482 65.558 1,438.161 4+ 1,820.181 3+ Y[pH5N4S] 5.1

Spectra

8436;EThcD;40.513;8434;1438.672;Byonic:q-value=8.29e-09/GPS:MinICScore=8.512
8438;HCD;40.523;8434;1438.672;