TG004971

From GPTWiki
Revision as of 18:40, 14 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide R.QLAHQSN[H5N4S2]STNIFFSPVSIATAFAM[Ox]LSLGTK.A (PE001184)
Sequence QLAHQSNSTNIFFSPVSIATAFAMLSLGTK
Glycans(s) H5N4S2 (N7)
Mod(s) 15.995 (M24)
Molecular Weight 5,419.406
Charge 4+
Protein SERPINA1 (P01009)
Spectrum File MS_51_ihilic_plasma_1ul
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction iHILIC
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
88.098 88.598 170.689 1,351.357 4+ 1,278.583 4+ Y[pH5N4S] 33.5
88.098 88.598 170.689 1,351.357 4+ 1,582.730 3+ Y[pH4N3S] 13.4
88.098 88.598 170.689 1,351.357 4+ 1,485.699 3+ Y[pH4N3] 12.7
88.098 88.598 170.689 1,351.357 4+ 1,700.859 2+ Y[pN] 9.5
88.098 88.598 170.689 1,351.357 4+ 1,431.681 3+ Y[pH3N3] 6.8
88.098 88.598 170.689 1,351.357 4+ 1,964.451 2+ Y[pH2N2] 5.9
88.098 88.598 170.689 1,351.357 4+ 1,528.713 3+ Y[pH3N3S] 5.7

Spectra

18090;EThcD;88.088;18084;1351.363;Byonic:q-value=2.36e-10/GPS:MinICScore=7.153
18092;HCD;88.098;18084;1351.363;