TG004821

From GPTWiki
Revision as of 17:37, 23 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H3N4]ITEENVQNMNNAGDKWSAFLK.E (PE001758)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H3N4 (N27)
Mod(s)
Molecular Weight 6,960.082
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
71.397 71.182 143.810 1,389.422 5+ 1,462.677 4+ Y[pN] 64.7
71.397 71.182 143.810 1,389.422 5+ 1,685.756 4+ Y[pH3N3] 44.6
71.397 71.182 143.810 1,389.422 5+ 1,645.243 4+ Y[pH2N3] 11.0
71.397 71.182 143.810 1,389.422 5+ 1,594.473 4+ Y[pH2N2] 13.1
71.397 71.182 143.810 1,389.422 5+ 1,513.446 4+ Y[pN2] 6.5
71.397 71.182 143.810 1,389.422 5+ 1,411.907 4+ Y[p] 5.7

Spectra

14398;EThcD;70.904;14397;1389.430;Byonic:q-value=4.29e-21/GPS:MinICScore=25.327
14399;HCD;70.910;14397;1389.430;
14506;EThcD;71.380;14504;1389.430;Byonic:q-value=4.46e-19/GPS:MinICScore=27.599
14508;HCD;71.397;14504;1389.430;
14594;EThcD;71.797;14593;1389.432;Byonic:q-value=1.14e-08/GPS:MinICScore=32.506
14596;HCD;71.806;14593;1389.432;