Difference between revisions of "TG004805"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{TransitionGroup |gphash=505b22a627 |mz1=1480.052 |nrt=153.223 |ntransition=12 |pepnrt=use (-2.346) |peptide=PE001760 |prt=74.930 |rt=74.977 |scans=15239;EThcD;74.964;15237;1...")
 
 
(2 intermediate revisions by the same user not shown)
Line 4: Line 4:
 
|nrt=153.223
 
|nrt=153.223
 
|ntransition=12
 
|ntransition=12
|pepnrt=use (-2.346)
+
|pepnrt=use (-2.524)
 
|peptide=PE001760
 
|peptide=PE001760
 
|prt=74.930
 
|prt=74.930
 
|rt=74.977
 
|rt=74.977
|scans=15239;EThcD;74.964;15237;1480.061;Byonic:q-value=2.03e-08/GPS:ICScore=37.250,15240;HCD;74.977;15237;1480.061;
+
|scans=15239;EThcD;74.964;15237;1480.061;Byonic:q-value=2.03e-08/GPS:MinICScore=37.250,15240;HCD;74.977;15237;1480.061;
 
|spectra=MS_50_ACE2_Trypsin
 
|spectra=MS_50_ACE2_Trypsin
 
|transitions=TR024313;94.7,TR024314;55.7,TR024814;25.5,TR024815;22.8,TR024315;15.2,TR024319;13.8,TR024318;12.4,TR024816;10.6,TR024817;10.4,TR024316;8.7,TR024818;7.2,TR024317;6.4
 
|transitions=TR024313;94.7,TR024314;55.7,TR024814;25.5,TR024815;22.8,TR024315;15.2,TR024319;13.8,TR024318;12.4,TR024816;10.6,TR024817;10.4,TR024316;8.7,TR024818;7.2,TR024317;6.4
 
|z1=5
 
|z1=5
 
}}
 
}}

Latest revision as of 17:37, 23 May 2021

Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H4N4S]ITEENVQNMNNAGDKWSAFLK.E (PE001760)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H4N4S (N27)
Mod(s)
Molecular Weight 7,413.23
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
74.977 74.930 153.223 1,480.052 5+ 1,462.677 4+ Y[pN] 94.7
74.977 74.930 153.223 1,480.052 5+ 1,685.756 4+ Y[pH3N3] 55.7
74.977 74.930 153.223 1,480.052 5+ 1,726.269 4+ Y[pH4N3] 25.5
74.977 74.930 153.223 1,480.052 5+ 1,645.243 4+ Y[pH2N3] 22.8
74.977 74.930 153.223 1,480.052 5+ 1,594.473 4+ Y[pH2N2] 15.2
74.977 74.930 153.223 1,480.052 5+ 1,421.833 5+ Y[pH4N4] 13.8
74.977 74.930 153.223 1,480.052 5+ 1,634.986 4+ Y[pH3N2] 12.4
74.977 74.930 153.223 1,480.052 5+ 1,553.960 4+ Y[pHN2] 10.6
74.977 74.930 153.223 1,480.052 5+ 1,411.907 4+ Y[p] 10.4
74.977 74.930 153.223 1,480.052 5+ 1,513.446 4+ Y[pN2] 8.7
74.977 74.930 153.223 1,480.052 5+ 1,777.039 4+ Y[pH4N4] 7.2
74.977 74.930 153.223 1,480.052 5+ 1,949.899 3+ Y[pN] 6.4

Spectra

15239;EThcD;74.964;15237;1480.061;Byonic:q-value=2.03e-08/GPS:MinICScore=37.250
15240;HCD;74.977;15237;1480.061;