Difference between revisions of "TG004778"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{TransitionGroup |gphash=d5cce04584 |mz1=1512.462 |nrt=152.487 |ntransition=6 |pepnrt=use (-2.596) |peptide=PE001763 |prt=74.637 |rt=74.813 |scans=15197;EThcD;74.764;15192;15...")
 
 
(2 intermediate revisions by the same user not shown)
Line 4: Line 4:
 
|nrt=152.487
 
|nrt=152.487
 
|ntransition=6
 
|ntransition=6
|pepnrt=use (-2.596)
+
|pepnrt=use (-2.699)
 
|peptide=PE001763
 
|peptide=PE001763
 
|prt=74.637
 
|prt=74.637
 
|rt=74.813
 
|rt=74.813
|scans=15197;EThcD;74.764;15192;1512.670;Byonic:q-value=3.68e-08/GPS:ICScore=48.536,15199;HCD;74.772;15192;1512.670;,15213;EThcD;74.844;15211;1512.471;Byonic:q-value=4.91e-08/GPS:ICScore=35.398,15215;HCD;74.854;15211;1512.471;
+
|scans=15197;EThcD;74.764;15192;1512.670;Byonic:q-value=3.68e-08/GPS:MinICScore=35.702,15199;HCD;74.772;15192;1512.670;,15213;EThcD;74.844;15211;1512.471;Byonic:q-value=4.91e-08/GPS:MinICScore=35.398,15215;HCD;74.854;15211;1512.471;
 
|spectra=MS_50_ACE2_Trypsin
 
|spectra=MS_50_ACE2_Trypsin
 
|transitions=TR024337;64.7,TR024338;25.2,TR024339;17.8,TR024827;34.8,TR024828;11.4,TR024340;6.6
 
|transitions=TR024337;64.7,TR024338;25.2,TR024339;17.8,TR024827;34.8,TR024828;11.4,TR024340;6.6
 
|z1=5
 
|z1=5
 
}}
 
}}

Latest revision as of 17:35, 23 May 2021

Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H5N4S]ITEENVQNMNNAGDKWSAFLK.E (PE001763)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H5N4S (N27)
Mod(s)
Molecular Weight 7,575.283
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
74.813 74.637 152.487 1,512.462 5+ 1,462.677 4+ Y[pN] 64.7
74.813 74.637 152.487 1,512.462 5+ 1,685.756 4+ Y[pH3N3] 25.2
74.813 74.637 152.487 1,512.462 5+ 1,513.446 4+ Y[pN2] 17.8
74.813 74.637 152.487 1,512.462 5+ 1,726.269 4+ Y[pH4N3] 34.8
74.813 74.637 152.487 1,512.462 5+ 1,454.243 5+ Y[pH5N4] 11.4
74.813 74.637 152.487 1,512.462 5+ 1,594.473 4+ Y[pH2N2] 6.6

Spectra

15197;EThcD;74.764;15192;1512.670;Byonic:q-value=3.68e-08/GPS:MinICScore=35.702
15199;HCD;74.772;15192;1512.670;
15213;EThcD;74.844;15211;1512.471;Byonic:q-value=4.91e-08/GPS:MinICScore=35.398
15215;HCD;74.854;15211;1512.471;