TG004760

From GPTWiki
Revision as of 17:44, 23 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H5N4S2]ITEENVQNMNNAGDKWSAFLK.E (PE001753)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H5N4S2 (N27)
Mod(s)
Molecular Weight 7,866.378
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
78.883 78.851 164.327 1,570.681 5+ 1,462.677 4+ Y[pN] 63.6
78.883 78.851 164.327 1,570.681 5+ 1,685.756 4+ Y[pH3N3] 24.1
78.883 78.851 164.327 1,570.681 5+ 1,513.446 4+ Y[pN2] 19.3
78.883 78.851 164.327 1,570.681 5+ 1,758.530 4+ Y[pH3N3S] 7.2
78.883 78.851 164.327 1,570.681 5+ 1,454.243 5+ Y[pH5N4] 6.7
78.883 78.851 164.327 1,570.681 5+ 1,411.907 4+ Y[p] 5.4
78.883 78.851 164.327 1,570.681 5+ 1,594.473 4+ Y[pH2N2] 5.3

Spectra

16614;EThcD;78.875;16608;1570.876;Byonic:q-value=5.35e-06/GPS:MinICScore=74.674
16616;HCD;78.883;16608;1570.876;