TG004753

From GPTWiki
Revision as of 22:06, 12 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide R.IFKEAEKFFVSVGLPN[H6N5F3]MTQGFWENSMLTDPGNVQK.A (PE001683)
Sequence IFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQK
Glycans(s) H6N5F3 (N16)
Mod(s)
Molecular Weight 6,431.852
Charge 4+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein