Difference between revisions of "TG004753"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{TransitionGroup |gphash=3e7420cbe6 |mz1=1604.468 |nrt=141.154 |ntransition=4 |pepnrt=drop (+13.935) |peptide=PE001683 |prt=69.720 |rt=69.583 |scans=14515;EThcD;69.574;14507;...")
 
 
Line 1: Line 1:
 
{{TransitionGroup
 
{{TransitionGroup
|gphash=3e7420cbe6
 
|mz1=1604.468
 
|nrt=141.154
 
|ntransition=4
 
|pepnrt=drop (+13.935)
 
 
|peptide=PE001683
 
|peptide=PE001683
|prt=69.720
 
|rt=69.583
 
|scans=14515;EThcD;69.574;14507;1604.479;Byonic:q-value=0.00011/GPS:ICScore=143.702,14517;HCD;69.583;14507;1604.479;
 
 
|spectra=MS_50_ACE2_Trypsin_2
 
|spectra=MS_50_ACE2_Trypsin_2
|transitions=TR023461;8.5,TR023462;5.9,TR023463;5.4,TR023464;5.4
 
 
|z1=4
 
|z1=4
 
}}
 
}}

Latest revision as of 22:06, 12 May 2021

Peptide R.IFKEAEKFFVSVGLPN[H6N5F3]MTQGFWENSMLTDPGNVQK.A (PE001683)
Sequence IFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQK
Glycans(s) H6N5F3 (N16)
Mod(s)
Molecular Weight 6,431.852
Charge 4+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein