TG004749

From GPTWiki
Revision as of 16:44, 23 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N3]STEAGQK.L (PE001769)
Sequence TLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQK
Glycans(s) H3N3 (N28)
Mod(s) 57.021 (C12), 57.021 (C24)
Molecular Weight 5,147.312
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
35.418 35.490 54.284 1,026.873 5+ 1,192.056 4+ Y[pH2N2] 100.0
35.418 35.490 54.284 1,026.873 5+ 1,232.570 4+ Y[pH3N2] 80.8
35.418 35.490 54.284 1,026.873 5+ 1,413.344 3+ Y[pN] 38.7
35.418 35.490 54.284 1,026.873 5+ 1,151.543 4+ Y[pHN2] 36.6
35.418 35.490 54.284 1,026.873 5+ 1,060.260 4+ Y[pN] 20.9
35.418 35.490 54.284 1,026.873 5+ 1,481.037 3+ Y[pN2] 6.3
35.418 35.490 54.284 1,026.873 5+ 1,535.055 3+ Y[pHN2] 5.0

Spectra

6712;EThcD;35.420;6708;1026.873;Byonic:q-value=0.00536/GPS:MinICScore=18.938
6714;HCD;35.428;6708;1026.873;