Difference between revisions of "TG004748"

From GPTWiki
Jump to navigation Jump to search
 
Line 4: Line 4:
 
|nrt=53.682
 
|nrt=53.682
 
|ntransition=7
 
|ntransition=7
|pepnrt=use (+1.642)
+
|pepnrt=use (+1.640)
 
|peptide=PE001775
 
|peptide=PE001775
 
|prt=35.253
 
|prt=35.253

Latest revision as of 16:44, 23 May 2021

Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N5F]STEAGQK.L (PE001775)
Sequence TLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQK
Glycans(s) H3N5F (N28)
Mod(s) 57.021 (C12), 57.021 (C24)
Molecular Weight 5,699.529
Charge 6+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
34.904 35.253 53.682 947.932 6+ 1,319.854 4+ Y[pH3N3F] 19.9
34.904 35.253 53.682 947.932 6+ 1,279.341 4+ Y[pH2N3F] 11.5
34.904 35.253 53.682 947.932 6+ 1,413.344 3+ Y[pN] 8.2
34.904 35.253 53.682 947.932 6+ 1,228.571 4+ Y[pH2N2F] 7.1
34.904 35.253 53.682 947.932 6+ 1,589.073 3+ Y[pH2N2] 6.0
34.904 35.253 53.682 947.932 6+ 1,242.826 4+ Y[pH2N3] 5.2
34.904 35.253 53.682 947.932 6+ 1,637.759 3+ Y[pH2N2F] 5.2

Spectra

6593;EThcD;34.895;6590;947.936;Byonic:q-value=4.32e-05/GPS:MinICScore=23.116
6595;HCD;34.904;6590;947.936;