TG004738

From GPTWiki
Revision as of 18:13, 14 May 2021 by Edwardsnj (talk | contribs)
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H3N4]ITEENVQNMNNAGDKWSAFLK.E (PE001758)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H3N4 (N27)
Mod(s)
Molecular Weight 6,960.082
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
71.353 71.005 144.415 1,389.422 5+ 1,462.677 4+ Y[pN] 38.7
71.353 71.005 144.415 1,389.422 5+ 1,685.756 4+ Y[pH3N3] 27.0
71.353 71.005 144.415 1,389.422 5+ 1,645.243 4+ Y[pH2N3] 7.1
71.353 71.005 144.415 1,389.422 5+ 1,634.986 4+ Y[pH3N2] 5.3

Spectra

14804;EThcD;70.813;14797;1389.427;Byonic:q-value=3.72e-22/GPS:MinICScore=24.394
14806;HCD;70.821;14797;1389.427;
14931;EThcD;71.361;14925;1389.431;Byonic:q-value=2.68e-24/GPS:MinICScore=26.103
14933;HCD;71.369;14925;1389.431;