Difference between revisions of "TG004738"

From GPTWiki
Jump to navigation Jump to search
 
Line 1: Line 1:
 
{{TransitionGroup
 
{{TransitionGroup
|gphash=27c65d7fd1
 
|mz1=1389.422
 
|nrt=144.415
 
|ntransition=4
 
|pepnrt=use (+0.518)
 
 
|peptide=PE001758
 
|peptide=PE001758
|prt=71.005
 
|rt=71.353
 
|scans=14804;EThcD;70.813;14797;1389.427;Byonic:q-value=3.72e-22/GPS:MinICScore=24.394,14806;HCD;70.821;14797;1389.427;,14931;EThcD;71.361;14925;1389.431;Byonic:q-value=2.68e-24/GPS:MinICScore=26.103,14933;HCD;71.369;14925;1389.431;
 
 
|spectra=MS_50_ACE2_Trypsin_2
 
|spectra=MS_50_ACE2_Trypsin_2
|transitions=TR024300;38.7,TR024301;27.0,TR024303;7.1,TR031285;5.3
 
 
|z1=5
 
|z1=5
 
}}
 
}}

Latest revision as of 23:31, 20 May 2021

Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H3N4]ITEENVQNMNNAGDKWSAFLK.E (PE001758)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H3N4 (N27)
Mod(s)
Molecular Weight 6,960.082
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein