Difference between revisions of "TG004726"

From GPTWiki
Jump to navigation Jump to search
Line 3: Line 3:
 
|mz1=914.085
 
|mz1=914.085
 
|nrt=53.804
 
|nrt=53.804
|ntransition=5
+
|ntransition=8
 
|pepnrt=use (+1.200)
 
|pepnrt=use (+1.200)
 
|peptide=PE001772
 
|peptide=PE001772
Line 10: Line 10:
 
|scans=6592;EThcD;34.890;6590;914.090;Byonic:q-value=0.00656/GPS:MinICScore=32.126,6594;HCD;34.899;6590;914.090;,6684;EThcD;35.294;6682;914.087;Byonic:q-value=8.28e-07/GPS:MinICScore=23.824,6686;HCD;35.304;6682;914.087;
 
|scans=6592;EThcD;34.890;6590;914.090;Byonic:q-value=0.00656/GPS:MinICScore=32.126,6594;HCD;34.899;6590;914.090;,6684;EThcD;35.294;6682;914.087;Byonic:q-value=8.28e-07/GPS:MinICScore=23.824,6686;HCD;35.304;6682;914.087;
 
|spectra=MS_50_ACE2_Trypsin_2
 
|spectra=MS_50_ACE2_Trypsin_2
|transitions=TR024469;12.3,TR024471;10.4,TR024472;8.4,TR024474;7.7,TR024475;5.8
+
|transitions=TR024468;16.6,TR024469;12.3,TR024470;10.9,TR024471;10.4,TR024472;8.4,TR024473;8.2,TR024474;7.7,TR024475;5.8
 
|z1=6
 
|z1=6
 
}}
 
}}

Revision as of 20:01, 20 May 2021

Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N4F]STEAGQK.L (PE001772)
Sequence TLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQK
Glycans(s) H3N4F (N28)
Mod(s) 57.021 (C12), 57.021 (C24)
Molecular Weight 5,496.45
Charge 6+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
35.304 35.301 53.804 914.085 6+ 1,228.571 4+ Y[pH2N2F]* 16.6
35.304 35.301 53.804 914.085 6+ 1,192.056 4+ Y[pH2N2] 12.3
35.304 35.301 53.804 914.085 6+ 1,269.084 4+ Y[pH3N2F]* 10.9
35.304 35.301 53.804 914.085 6+ 1,151.543 4+ Y[pHN2] 10.4
35.304 35.301 53.804 914.085 6+ 1,060.260 4+ Y[pN] 8.4
35.304 35.301 53.804 914.085 6+ 1,188.058 4+ Y[pHN2F]* 8.2
35.304 35.301 53.804 914.085 6+ 1,413.344 3+ Y[pN] 7.7
35.304 35.301 53.804 914.085 6+ 1,232.570 4+ Y[pH3N2] 5.8

Spectra

6592;EThcD;34.890;6590;914.090;Byonic:q-value=0.00656/GPS:MinICScore=32.126
6594;HCD;34.899;6590;914.090;
6684;EThcD;35.294;6682;914.087;Byonic:q-value=8.28e-07/GPS:MinICScore=23.824
6686;HCD;35.304;6682;914.087;