TG004714

From GPTWiki
Revision as of 17:42, 23 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N3F]STEAGQK.L (PE001773)
Sequence TLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQK
Glycans(s) H3N3F (N28)
Mod(s) 57.021 (C12), 57.021 (C24)
Molecular Weight 5,293.37
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
35.128 35.356 53.944 1,056.085 5+ 1,228.571 4+ Y[pH2N2F] 70.2
35.128 35.356 53.944 1,056.085 5+ 1,269.084 4+ Y[pH3N2F] 61.4
35.128 35.356 53.944 1,056.085 5+ 1,192.056 4+ Y[pH2N2] 31.0
35.128 35.356 53.944 1,056.085 5+ 1,413.344 3+ Y[pN] 28.8
35.128 35.356 53.944 1,056.085 5+ 1,232.570 4+ Y[pH3N2] 21.0
35.128 35.356 53.944 1,056.085 5+ 1,151.543 4+ Y[pHN2] 16.9
35.128 35.356 53.944 1,056.085 5+ 1,188.058 4+ Y[pHN2F] 16.6
35.128 35.356 53.944 1,056.085 5+ 1,462.030 3+ Y[pNF] 13.5
35.128 35.356 53.944 1,056.085 5+ 1,060.260 4+ Y[pN] 13.1
35.128 35.356 53.944 1,056.085 5+ 1,111.030 4+ Y[pN2] 10.8
35.128 35.356 53.944 1,056.085 5+ 1,096.775 4+ Y[pNF] 10.3
35.128 35.356 53.944 1,056.085 5+ 1,147.545 4+ Y[pN2F] 9.3
35.128 35.356 53.944 1,056.085 5+ 1,589.073 3+ Y[pH2N2] 6.4
35.128 35.356 53.944 1,056.085 5+ 1,481.037 3+ Y[pN2] 5.2
35.128 35.356 53.944 1,056.085 5+ 1,535.055 3+ Y[pHN2] 5.3

Spectra

6612;EThcD;34.979;6602;1056.286;Byonic:q-value=0.00656/GPS:MinICScore=51.588
6614;HCD;34.988;6602;1056.286;
6644;EThcD;35.120;6638;1056.085;Byonic:q-value=6.91e-05/GPS:MinICScore=55.672
6646;HCD;35.128;6638;1056.085;
6745;EThcD;35.560;6740;1056.085;Byonic:q-value=0.00106/GPS:MinICScore=21.549
6746;HCD;35.566;6740;1056.085;