TG004713

From GPTWiki
Revision as of 17:42, 23 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N4F]STEAGQK.L (PE001772)
Sequence TLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQK
Glycans(s) H3N4F (N28)
Mod(s) 57.021 (C12), 57.021 (C24)
Molecular Weight 5,496.45
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
35.304 35.282 53.756 1,096.701 5+ 1,319.854 4+ Y[pH3N3F] 45.3
35.304 35.282 53.756 1,096.701 5+ 1,279.341 4+ Y[pH2N3F] 31.0
35.304 35.282 53.756 1,096.701 5+ 1,637.759 3+ Y[pH2N2F]* 15.3
35.304 35.282 53.756 1,096.701 5+ 1,589.073 3+ Y[pH2N2] 12.6
35.304 35.282 53.756 1,096.701 5+ 1,413.344 3+ Y[pN] 12.4
35.304 35.282 53.756 1,096.701 5+ 1,283.340 4+ Y[pH3N3] 10.2
35.304 35.282 53.756 1,096.701 5+ 1,242.826 4+ Y[pH2N3] 9.6
35.304 35.282 53.756 1,096.701 5+ 1,535.055 3+ Y[pHN2] 9.6
35.304 35.282 53.756 1,096.701 5+ 1,096.775 4+ Y[pNF]* 8.3
35.304 35.282 53.756 1,096.701 5+ 1,462.030 3+ Y[pNF]* 8.1
35.304 35.282 53.756 1,096.701 5+ 1,228.571 4+ Y[pH2N2F]* 7.8
35.304 35.282 53.756 1,096.701 5+ 1,583.741 3+ Y[pHN2F]* 7.5
35.304 35.282 53.756 1,096.701 5+ 1,691.776 3+ Y[pH3N2F]* 7.3
35.304 35.282 53.756 1,096.701 5+ 1,192.056 4+ Y[pH2N2] 5.5
35.304 35.282 53.756 1,096.701 5+ 1,060.260 4+ Y[pN] 5.1

Spectra

6772;EThcD;35.683;6767;1096.902;Byonic:q-value=0.00202/GPS:MinICScore=16.771
6774;HCD;35.691;6767;1096.902;