TG004692

From GPTWiki
Revision as of 16:41, 23 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H5N4FS]ITEENVQNMNNAGDKWSAFLK.E (PE001754)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H5N4FS (N27)
Mod(s)
Molecular Weight 7,721.341
Charge 6+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
75.087 75.178 155.006 1,284.896 6+ 1,462.677 4+ Y[pN] 44.0
75.087 75.178 155.006 1,284.896 6+ 1,634.986 4+ Y[pH3N2] 11.0
75.087 75.178 155.006 1,284.896 6+ 1,170.343 5+ Y[pN] 9.6
75.087 75.178 155.006 1,284.896 6+ 1,499.191 4+ Y[pNF]* 7.3
75.087 75.178 155.006 1,284.896 6+ 1,411.907 4+ Y[p] 7.2
75.087 75.178 155.006 1,284.896 6+ 1,513.446 4+ Y[pN2] 6.3
75.087 75.178 155.006 1,284.896 6+ 1,553.960 4+ Y[pHN2] 6.1
75.087 75.178 155.006 1,284.896 6+ 1,671.500 4+ Y[pH3N2F]* 5.5
75.087 75.178 155.006 1,284.896 6+ 1,630.987 4+ Y[pH2N2F]* 5.3

Spectra

15868;EThcD;75.495;15863;1285.069;Byonic:q-value=0.00202/GPS:MinICScore=122.340
15870;HCD;75.503;15863;1285.069;