TG004660

From GPTWiki
Revision as of 17:40, 23 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H4N5F]ITEENVQNMNNAGDKWSAFLK.E (PE001765)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H4N5F (N27)
Mod(s)
Molecular Weight 7,471.272
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
71.258 71.255 145.050 1,491.660 5+ 1,462.677 4+ Y[pN] 28.0
71.258 71.255 145.050 1,491.660 5+ 1,813.553 4+ Y[pH4N4F] 14.7
71.258 71.255 145.050 1,491.660 5+ 1,773.040 4+ Y[pH3N4F] 11.5
71.258 71.255 145.050 1,491.660 5+ 1,777.039 4+ Y[pH4N4] 8.8
71.258 71.255 145.050 1,491.660 5+ 1,499.191 4+ Y[pNF]* 8.6
71.258 71.255 145.050 1,491.660 5+ 1,736.526 4+ Y[pH3N4] 7.3
71.258 71.255 145.050 1,491.660 5+ 1,685.756 4+ Y[pH3N3] 6.1
71.258 71.255 145.050 1,491.660 5+ 1,722.270 4+ Y[pH3N3F] 5.1

Spectra

14904;EThcD;71.249;14898;1491.664;Byonic:q-value=3.9e-15/GPS:MinICScore=55.935
14906;HCD;71.258;14898;1491.664;