TG004656

From GPTWiki
Revision as of 17:40, 23 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Peptide K.EAEKFFVSVGLPN[H3N3F]MTQGFWENSMLTDPGNVQK.A (PE001667)
Sequence EAEKFFVSVGLPNMTQGFWENSMLTDPGNVQK
Glycans(s) H3N3F (N13)
Mod(s)
Molecular Weight 4,859.172
Charge 4+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
60.429 60.578 117.953 1,211.298 4+ 1,493.017 3+ Y[pH2N2F] 10.2
60.429 60.578 117.953 1,211.298 4+ 1,444.331 3+ Y[pH2N2] 9.2
60.429 60.578 117.953 1,211.298 4+ 1,547.035 3+ Y[pH3N2F] 9.2
60.429 60.578 117.953 1,211.298 4+ 1,268.603 3+ Y[pN] 8.3
60.429 60.578 117.953 1,211.298 4+ 1,498.349 3+ Y[pH3N2] 7.6
60.429 60.578 117.953 1,211.298 4+ 1,902.401 2+ Y[pN] 7.2
60.429 60.578 117.953 1,211.298 4+ 1,336.296 3+ Y[pN2] 5.4

Spectra

12390;EThcD;60.420;12385;1211.305;Byonic:q-value=3.6e-14/GPS:MinICScore=6.960
12392;HCD;60.429;12385;1211.305;